SCOPe 2.07: Domain d1b2pb_: 1b2p B:

Lineage for d1b2pb_ (1b2p B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)

6. Protein Lectin (agglutinin) [51112] (4 species)

7. Species Bluebell (Scilla campanulata) [TaxId:81759] [51116] (1 PDB entry)

8. Domain d1b2pb_: 1b2p B: [27999]

Details for d1b2pb_

PDB Entry: 1b2p, 1.7 Å

PDB Description: native mannose-specific bulb lectin from scilla campanulata (bluebell) at 1.7 angstroms resolution

PDB Compounds: (B:) protein (lectin)

SCOPe Domain Sequences for d1b2pb_:

Sequence; same for both SEQRES and ATOM records:

>d1b2pb_ b.78.1.1 (B:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]}
nniifskqpddnhpqilhatesleilfgthvyrfimqtdcnlvlydnnnpiwatntgglg
ngcravlqpdgvlvvitnenvtvwqspvagkaghyvlvlqpdrnvviygdalwatqtvr

Timeline for d1b2pb_:

• d1b2pb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b2pb_ appears in SCOPe 2.06
  
• d1b2pb_ appears in the current release, SCOPe 2.08