| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
| Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
| Protein automated matches [190143] (41 species) not a true protein |
| Species Liberibacter asiaticus [TaxId:537021] [279984] (1 PDB entry) |
| Domain d4zw0c_: 4zw0 C: [279989] automated match to d3d6xb_ |
PDB Entry: 4zw0 (more details), 2.9 Å
SCOPe Domain Sequences for d4zw0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zw0c_ d.38.1.0 (C:) automated matches {Liberibacter asiaticus [TaxId: 537021]}
ldakdivelmrflphrypfllvdkvvniqrdesaigiknvtfnephfmghfpgrpvmpgv
lilegmaqtagaicaihngfdqyappylmsidkarfrkpvfpgdrleyhvnkvrnrvdlw
kfqccakventvvaeaeicamvmh
Timeline for d4zw0c_: