Lineage for d4zw0a_ (4zw0 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188470Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2188471Protein automated matches [190143] (36 species)
    not a true protein
  7. 2188561Species Liberibacter asiaticus [TaxId:537021] [279984] (1 PDB entry)
  8. 2188562Domain d4zw0a_: 4zw0 A: [279988]
    automated match to d3d6xb_

Details for d4zw0a_

PDB Entry: 4zw0 (more details), 2.9 Å

PDB Description: crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from candidatus asiaticum
PDB Compounds: (A:) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

SCOPe Domain Sequences for d4zw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zw0a_ d.38.1.0 (A:) automated matches {Liberibacter asiaticus [TaxId: 537021]}
ldakdivelmrflphrypfllvdkvvniqrdesaigiknvtfnephfmghfpgrpvmpgv
lilegmaqtagaicaihngfdqyappylmsidkarfrkpvfpgdrleyhvnkvrnrvdlw
kfqccakventvvaeaeicamv

SCOPe Domain Coordinates for d4zw0a_:

Click to download the PDB-style file with coordinates for d4zw0a_.
(The format of our PDB-style files is described here.)

Timeline for d4zw0a_: