Lineage for d4z7sa_ (4z7s A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066356Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2066357Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 protein domains)
  6. 2066358Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 2066359Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (24 PDB entries)
    Uniprot P08514 32-483
  8. 2066389Domain d4z7sa_: 4z7s A: [279982]
    Other proteins in same PDB: d4z7sf1, d4z7sf2, d4z7sl1, d4z7sl2
    automated match to d3niga_
    complexed with 4m3, bma, ca, cl, gol, man, mg, nag, so4

Details for d4z7sa_

PDB Entry: 4z7s (more details), 2.7 Å

PDB Description: integrin alphaiibbeta3 in complex with ro-435054
PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d4z7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7sa_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqpvv

SCOPe Domain Coordinates for d4z7sa_:

Click to download the PDB-style file with coordinates for d4z7sa_.
(The format of our PDB-style files is described here.)

Timeline for d4z7sa_: