Lineage for d1b2pa_ (1b2p A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17659Fold b.78: beta-Prism II [51109] (1 superfamily)
  4. 17660Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (1 family) (S)
  5. 17661Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (2 proteins)
  6. 17676Protein Lectin (agglutinin) [51112] (4 species)
  7. 17677Species Bluebell (Scilla campanulata) [TaxId:81759] [51116] (1 PDB entry)
  8. 17678Domain d1b2pa_: 1b2p A: [27998]

Details for d1b2pa_

PDB Entry: 1b2p (more details), 1.7 Å

PDB Description: native mannose-specific bulb lectin from scilla campanulata (bluebell) at 1.7 angstroms resolution

SCOP Domain Sequences for d1b2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata)}
nniifskqpddnhpqilhatesleilfgthvyrfimqtdcnlvlydnnnpiwatntgglg
ngcravlqpdgvlvvitnenvtvwqspvagkaghyvlvlqpdrnvviygdalwatqtvr

SCOP Domain Coordinates for d1b2pa_:

Click to download the PDB-style file with coordinates for d1b2pa_.
(The format of our PDB-style files is described here.)

Timeline for d1b2pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b2pb_