SCOPe 2.05: Domain d1bwuq_: 1bwu Q:

Lineage for d1bwuq_ (1bwu Q:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)

6. Protein Lectin (agglutinin) [51112] (4 species)

7. Species Garlic (Allium sativum) [TaxId:4682] [51114] (2 PDB entries)

8. Domain d1bwuq_: 1bwu Q: [27996]
   complexed with man

Details for d1bwuq_

PDB Entry: 1bwu, 2.8 Å

PDB Description: mannose-specific agglutinin (lectin) from garlic (allium sativum) bulbs complexed with alpha-d-mannose

PDB Compounds: (Q:) protein (agglutinin)

SCOPe Domain Sequences for d1bwuq_:

Sequence; same for both SEQRES and ATOM records:

>d1bwuq_ b.78.1.1 (Q:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]}
rniltndeglyagqsldvnpyhlimqedcnlvlydhstavwssntdipgkkgckavlqsd
gnfvvydaegaslwashsvrgngnyvlvlqedgnvviygsdiwstntyk

Timeline for d1bwuq_:

• d1bwuq_ first appeared (with stable ids) in SCOP 1.55
  
• d1bwuq_ appears in SCOPe 2.04
  
• d1bwuq_ appears in SCOPe 2.06
  
• d1bwuq_ appears in the current release, SCOPe 2.08