Lineage for d5f6ta_ (5f6t A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711619Species Doryteuthis pealeii [TaxId:1051067] [260698] (4 PDB entries)
  8. 2711624Domain d5f6ta_: 5f6t A: [279922]
    automated match to d2ccma_
    complexed with ca, gd

Details for d5f6ta_

PDB Entry: 5f6t (more details), 2.2 Å

PDB Description: structure of calexcitin-gd3+ complex.
PDB Compounds: (A:) calexcitin

SCOPe Domain Sequences for d5f6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f6ta_ a.39.1.0 (A:) automated matches {Doryteuthis pealeii [TaxId: 1051067]}
qlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearatlkl
iwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndtsgdn
iidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgakgnh
lfgtl

SCOPe Domain Coordinates for d5f6ta_:

Click to download the PDB-style file with coordinates for d5f6ta_.
(The format of our PDB-style files is described here.)

Timeline for d5f6ta_: