Lineage for d1nivc_ (1niv C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402758Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2402759Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2402760Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 protein domains)
  6. 2402782Protein Lectin (agglutinin) [51112] (4 species)
  7. 2402799Species Snowdrop (Galanthus nivalis) [TaxId:4670] [51113] (3 PDB entries)
  8. 2402806Domain d1nivc_: 1niv C: [27992]
    complexed with mdm

Details for d1nivc_

PDB Entry: 1niv (more details), 3 Å

PDB Description: mannose-specific agglutinin (lectin) from snowdrop (galanthus nivalis) bulbs in complex with mannose-alpha 1,3-methyl-d-mannose
PDB Compounds: (C:) agglutinin

SCOPe Domain Sequences for d1nivc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nivc_ b.78.1.1 (C:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]}
dnilysgetlstgeflnygsfvfimqedcnlvlydvdkpiwatntgglsrscflsmqtdg
nlvvynpsnkpiwasntggqngnyvcilqkdrnvviygtdrwatgtht

SCOPe Domain Coordinates for d1nivc_:

Click to download the PDB-style file with coordinates for d1nivc_.
(The format of our PDB-style files is described here.)

Timeline for d1nivc_: