Lineage for d5eyfa_ (5eyf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915521Species Enterococcus faecium [TaxId:333849] [279906] (1 PDB entry)
  8. 2915522Domain d5eyfa_: 5eyf A: [279907]
    Other proteins in same PDB: d5eyfb2
    automated match to d2v25a_
    complexed with cl, ggl, mg

Details for d5eyfa_

PDB Entry: 5eyf (more details), 1.52 Å

PDB Description: crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
PDB Compounds: (A:) Glutamate ABC superfamily ATP binding cassette transporter, binding protein

SCOPe Domain Sequences for d5eyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eyfa_ c.94.1.0 (A:) automated matches {Enterococcus faecium [TaxId: 333849]}
edilerskstneiiwgvkydtrlfgmmdiesrtvqgfdvdiakaitkkilgdngktefve
vtsktripllkngnidaiiatmtitderkkqvdfsdvyfdagqallvkkgsqiksvddln
asttvlavkgstsaanirqhapdakilelenyaeaftalqsgqgdamttdnaillgiade
npeyelvggtftnepygiainkgqenflkavnqaleemhadgtydkiyqkwfpnetegkv
e

SCOPe Domain Coordinates for d5eyfa_:

Click to download the PDB-style file with coordinates for d5eyfa_.
(The format of our PDB-style files is described here.)

Timeline for d5eyfa_: