SCOPe 2.07: Domain d5eyfa_: 5eyf A:

Lineage for d5eyfa_ (5eyf A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (146 species)
   not a true protein

7. Species Enterococcus faecium [TaxId:333849] [279906] (1 PDB entry)

8. Domain d5eyfa_: 5eyf A: [279907]
   Other proteins in same PDB: d5eyfb2
   automated match to d2v25a_
   complexed with cl, ggl, mg

Details for d5eyfa_

PDB Entry: 5eyf, 1.52 Å

PDB Description: crystal structure of solute-binding protein from enterococcus faecium with bound glutamate

PDB Compounds: (A:) Glutamate ABC superfamily ATP binding cassette transporter, binding protein

SCOPe Domain Sequences for d5eyfa_:

Sequence; same for both SEQRES and ATOM records:

>d5eyfa_ c.94.1.0 (A:) automated matches {Enterococcus faecium [TaxId: 333849]}
edilerskstneiiwgvkydtrlfgmmdiesrtvqgfdvdiakaitkkilgdngktefve
vtsktripllkngnidaiiatmtitderkkqvdfsdvyfdagqallvkkgsqiksvddln
asttvlavkgstsaanirqhapdakilelenyaeaftalqsgqgdamttdnaillgiade
npeyelvggtftnepygiainkgqenflkavnqaleemhadgtydkiyqkwfpnetegkv
e

Timeline for d5eyfa_:

• d5eyfa_ first appeared in SCOPe 2.05
  
• d5eyfa_ appears in SCOPe 2.06