Lineage for d5e0qa_ (5e0q A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758808Species Vicugna pacos [TaxId:30538] [189756] (9 PDB entries)
  8. 1758818Domain d5e0qa_: 5e0q A: [279904]
    automated match to d4krpb_

Details for d5e0qa_

PDB Entry: 5e0q (more details), 1.9 Å

PDB Description: crystal structure of the nup98 c-terminal domain bound to nanobody tp377
PDB Compounds: (A:) Anti-Nup98 Nanobody TP377

SCOPe Domain Sequences for d5e0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e0qa_ b.1.1.1 (A:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesgggpveaggslrlscaasgrsfsnsvmawfrqapgkereflsvlnwssgrtsi
adsvkgrftmsrdpakitvylqmnglkpedtavyycaasnrgslytldnqnryedwgqgt
qvtvss

SCOPe Domain Coordinates for d5e0qa_:

Click to download the PDB-style file with coordinates for d5e0qa_.
(The format of our PDB-style files is described here.)

Timeline for d5e0qa_: