SCOPe 2.07: Domain d5djbg_: 5djb G:

Lineage for d5djbg_ (5djb G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.0: automated matches [195116] (1 protein)
   not a true family

6. Protein automated matches [195117] (12 species)
   not a true protein

7. Species Haliangium ochraceum [TaxId:502025] [279894] (3 PDB entries)

8. Domain d5djbg_: 5djb G: [279903]
   automated match to d4axja_

Details for d5djbg_

PDB Entry: 5djb, 1.8 Å

PDB Description: structure of the haliangium ochraceum bmc-h shell protein

PDB Compounds: (G:) Microcompartments protein

SCOPe Domain Sequences for d5djbg_:

Sequence; same for both SEQRES and ATOM records:

>d5djbg_ d.58.56.0 (G:) automated matches {Haliangium ochraceum [TaxId: 502025]}
adalgmievrgfvgmveaadamvkaakveligyektgggyvtavvrgdvaavkaateagq
raaervgevvavhviprphvnvdaalplgrtpgm

Timeline for d5djbg_:

• d5djbg_ first appeared in SCOPe 2.05
  
• d5djbg_ appears in SCOPe 2.06
  
• d5djbg_ appears in the current release, SCOPe 2.08