Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
Protein automated matches [195117] (12 species) not a true protein |
Species Haliangium ochraceum [TaxId:502025] [279894] (3 PDB entries) |
Domain d5djbg_: 5djb G: [279903] automated match to d4axja_ |
PDB Entry: 5djb (more details), 1.8 Å
SCOPe Domain Sequences for d5djbg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5djbg_ d.58.56.0 (G:) automated matches {Haliangium ochraceum [TaxId: 502025]} adalgmievrgfvgmveaadamvkaakveligyektgggyvtavvrgdvaavkaateagq raaervgevvavhviprphvnvdaalplgrtpgm
Timeline for d5djbg_: