Lineage for d5dfva_ (5dfv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733579Protein automated matches [256548] (3 species)
    not a true protein
  7. 2733582Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries)
  8. 2733614Domain d5dfva_: 5dfv A: [279893]
    Other proteins in same PDB: d5dfvc1, d5dfvc2, d5dfvd1, d5dfvd2, d5dfve1, d5dfve2, d5dfvf1, d5dfvf2
    automated match to d4bkha_

Details for d5dfva_

PDB Entry: 5dfv (more details), 2.8 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with murine fab fragment k04
PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d5dfva_:

Sequence, based on SEQRES records: (download)

>d5dfva_ a.135.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgkh

Sequence, based on observed residues (ATOM records): (download)

>d5dfva_ a.135.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsniisnlfkedchqkiddlfsgkh

SCOPe Domain Coordinates for d5dfva_:

Click to download the PDB-style file with coordinates for d5dfva_.
(The format of our PDB-style files is described here.)

Timeline for d5dfva_: