SCOPe 2.06: Domain d5dfvb_: 5dfv B:

Lineage for d5dfvb_ (5dfv B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.135: Tetraspanin [48651] (1 superfamily)
   5 helices: irregular disulfide-linked array; form homodimer

4. Superfamily a.135.1: Tetraspanin [48652] (1 family)

5. Family a.135.1.1: Tetraspanin [48653] (2 proteins)

6. Protein automated matches [256548] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256549] (11 PDB entries)

8. Domain d5dfvb_: 5dfv B: [279892]
   Other proteins in same PDB: d5dfvd1, d5dfvd2, d5dfvf1, d5dfvf2
   automated match to d4bkha_

Details for d5dfvb_

PDB Entry: 5dfv, 2.8 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with murine fab fragment k04

PDB Compounds: (B:) CD81 antigen

SCOPe Domain Sequences for d5dfvb_:

Sequence, based on SEQRES records:

>d5dfvb_ a.135.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgkh

Sequence, based on observed residues (ATOM records):

>d5dfvb_ a.135.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsisnlfkedchqkiddlfsgkh

Timeline for d5dfvb_:

• d5dfvb_ first appeared in SCOPe 2.05
  
• d5dfvb_ appears in SCOPe 2.07
  
• d5dfvb_ appears in the current release, SCOPe 2.08