SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1msac_ (1msa C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069078Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2069079Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2069080Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 protein domains)
  6. 2069102Protein Lectin (agglutinin) [51112] (4 species)
  7. 2069119Species Snowdrop (Galanthus nivalis) [TaxId:4670] [51113] (3 PDB entries)
  8. 2069123Domain d1msac_: 1msa C: [27989]
    complexed with mma

Details for d1msac_

PDB Entry: 1msa (more details), 2.29 Å

PDB Description: mannose-specific agglutinin (lectin) from snowdrop (galanthus nivalis) bulbs complexed with methyl-alpha-d-mannoside
PDB Compounds: (C:) agglutinin

SCOPe Domain Sequences for d1msac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msac_ b.78.1.1 (C:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]}
dnilysgetlstgeflnygsfvfimqedcnlvlydvdkpiwatntgglsrscflsmqtdg
nlvvynpsnkpiwasntggqngnyvcilqkdrnvviygtdrwatgthtg

SCOPe Domain Coordinates for d1msac_:

Click to download the PDB-style file with coordinates for d1msac_.
(The format of our PDB-style files is described here.)

Timeline for d1msac_: