Lineage for d5acca_ (5acc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342719Domain d5acca_: 5acc A: [279880]
    automated match to d1qkta_
    complexed with ke9; mutant

Details for d5acca_

PDB Entry: 5acc (more details), 1.88 Å

PDB Description: a novel oral selective estrogen receptor down-regulator, azd9496, drives tumour growth inhibition in estrogen receptor positive and esr1 mutant models
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d5acca_:

Sequence, based on SEQRES records: (download)

>d5acca_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld

Sequence, based on observed residues (ATOM records): (download)

>d5acca_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfsmmglltnladrelvhminwakrvpgfvd
ltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmll
atssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmak
agltlqqqhqrlaqlllilshirhmsnkgmehlysmvpsydlllemld

SCOPe Domain Coordinates for d5acca_:

Click to download the PDB-style file with coordinates for d5acca_.
(The format of our PDB-style files is described here.)

Timeline for d5acca_: