SCOPe 2.06: Domain d1msab_: 1msa B:

Lineage for d1msab_ (1msa B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)

6. Protein Lectin (agglutinin) [51112] (4 species)

7. Species Snowdrop (Galanthus nivalis) [TaxId:4670] [51113] (3 PDB entries)

8. Domain d1msab_: 1msa B: [27988]
   complexed with mma

Details for d1msab_

PDB Entry: 1msa, 2.29 Å

PDB Description: mannose-specific agglutinin (lectin) from snowdrop (galanthus nivalis) bulbs complexed with methyl-alpha-d-mannoside

PDB Compounds: (B:) agglutinin

SCOPe Domain Sequences for d1msab_:

Sequence; same for both SEQRES and ATOM records:

>d1msab_ b.78.1.1 (B:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]}
dnilysgetlstgeflnygsfvfimqedcnlvlydvdkpiwatntgglsrscflsmqtdg
nlvvynpsnkpiwasntggqngnyvcilqkdrnvviygtdrwatgthtg

Timeline for d1msab_:

• d1msab_ first appeared (with stable ids) in SCOP 1.55
  
• d1msab_ appears in SCOPe 2.05
  
• d1msab_ appears in SCOPe 2.07
  
• d1msab_ appears in the current release, SCOPe 2.08