SCOPe 2.05: Domain d5a92a_: 5a92 A:

Lineage for d5a92a_ (5a92 A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (23 PDB entries)

8. Domain d5a92a_: 5a92 A: [279868]
   automated match to d2zq7a_
   complexed with pcz, so4

Details for d5a92a_

PDB Entry: 5a92, 1.05 Å

PDB Description: 15k x-ray structure with cefotaxime: exploring the mechanism of beta- lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography

PDB Compounds: (A:) beta-lactamase ctx-m-97

SCOPe Domain Sequences for d5a92a_:

Sequence; same for both SEQRES and ATOM records:

>d5a92a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaenrndilaaaakivthgf

Timeline for d5a92a_:

• d5a92a_ is new in SCOPe 2.05-stable
  
• d5a92a_ appears in SCOPe 2.06
  
• d5a92a_ appears in the current release, SCOPe 2.08