Lineage for d5a91a_ (5a91 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949540Protein beta-Lactamase, class A [56606] (16 species)
  7. 1949634Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (23 PDB entries)
  8. 1949643Domain d5a91a_: 5a91 A: [279865]
    automated match to d2zq7a_
    complexed with so4

Details for d5a91a_

PDB Entry: 5a91 (more details), 1.2 Å

PDB Description: 15k x-ray ligand free: exploring the mechanism of beta-lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography

SCOPe Domain Sequences for d5a91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a91a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaenrndilaaaakivthgf

SCOPe Domain Coordinates for d5a91a_:

Click to download the PDB-style file with coordinates for d5a91a_.
(The format of our PDB-style files is described here.)

Timeline for d5a91a_: