Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [189148] (6 PDB entries) |
Domain d4zl8a_: 4zl8 A: [279863] automated match to d3h93a_ complexed with gol, mes |
PDB Entry: 4zl8 (more details), 1.4 Å
SCOPe Domain Sequences for d4zl8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zl8a_ c.47.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} dytagkeyvelsspvpvsqpgkievvelfwygcphcyafeptivpwseklpadvhfvrlp alfggiwnvhgqmfltlismgvehdvhnavfeaihkehkklatpeemadflagkgvdkek flstynsfaikgqmekakklamayqvtgvptmvvngkyrfdigsaggpeetlkladylie keraaak
Timeline for d4zl8a_: