Lineage for d4zl8a_ (4zl8 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855365Species Pseudomonas aeruginosa [TaxId:208964] [189148] (6 PDB entries)
  8. 1855367Domain d4zl8a_: 4zl8 A: [279863]
    automated match to d3h93a_
    complexed with gol, mes

Details for d4zl8a_

PDB Entry: 4zl8 (more details), 1.4 Å

PDB Description: crystal structure of pseudomonas aeruginosa dsba e82i: crystal ii
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d4zl8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zl8a_ c.47.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
dytagkeyvelsspvpvsqpgkievvelfwygcphcyafeptivpwseklpadvhfvrlp
alfggiwnvhgqmfltlismgvehdvhnavfeaihkehkklatpeemadflagkgvdkek
flstynsfaikgqmekakklamayqvtgvptmvvngkyrfdigsaggpeetlkladylie
keraaak

SCOPe Domain Coordinates for d4zl8a_:

Click to download the PDB-style file with coordinates for d4zl8a_.
(The format of our PDB-style files is described here.)

Timeline for d4zl8a_: