SCOPe 2.06: Domain d4y6mb_: 4y6m B:

Lineage for d4y6mb_ (4y6m B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (22 PDB entries)

8. Domain d4y6mb_: 4y6m B: [279860]
   automated match to d1leea_
   complexed with 48q, gol

Details for d4y6mb_

PDB Entry: 4y6m, 2.27 Å

PDB Description: structure of plasmepsin ii from plasmodium falciparum complexed with inhibitor pg418

PDB Compounds: (B:) Plasmepsin-2

SCOPe Domain Sequences for d4y6mb_:

Sequence; same for both SEQRES and ATOM records:

>d4y6mb_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
sndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydss
ksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfd
gilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegp
ltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpf
lpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfil
gdpfmrkyftvfdydnhsvgialakknl

Timeline for d4y6mb_:

• d4y6mb_ first appeared in SCOPe 2.05
  
• d4y6mb_ appears in SCOPe 2.07
  
• d4y6mb_ appears in the current release, SCOPe 2.08