SCOPe 2.06: Domain d4y31a_: 4y31 A:

Lineage for d4y31a_ (4y31 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Plant pathogenesis-related protein PR10 [75543] (2 species)

7. Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries)

8. Domain d4y31a_: 4y31 A: [279858]
   automated match to d1icxa_
   complexed with act

Details for d4y31a_

PDB Entry: 4y31, 1.32 Å

PDB Description: crystal structure of yellow lupine llpr-10.1a protein in ligand-free form

PDB Compounds: (A:) protein llr18a

SCOPe Domain Sequences for d4y31a_:

Sequence, based on SEQRES records:

>d4y31a_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
tkgdvlsetvrdqakfkglglfkaiegyvlahpdy

Sequence, based on observed residues (ATOM records):

>d4y31a_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaiht
sfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfhtkg
dvlsetvrdqfkglglfkaiegyvlahpdy

Timeline for d4y31a_:

• d4y31a_ first appeared in SCOPe 2.05
  
• d4y31a_ appears in SCOPe 2.07
  
• d4y31a_ appears in the current release, SCOPe 2.08