Lineage for d4x37a_ (4x37 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061865Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 2061866Protein automated matches [190764] (2 species)
    not a true protein
  7. 2061867Species Chicken (Gallus gallus) [TaxId:9031] [255980] (6 PDB entries)
  8. 2061871Domain d4x37a_: 4x37 A: [279852]
    automated match to d2wrya_
    mutant

Details for d4x37a_

PDB Entry: 4x37 (more details), 1.63 Å

PDB Description: gallus interleukin-1 mutant - e118k
PDB Compounds: (A:) IL-1 beta

SCOPe Domain Sequences for d4x37a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x37a_ b.42.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
afrytrsqsfdifdinqkcfvlesptqlvalhlqgpsssqkvrlnialyrprgprgsagt
gqmpvalgikgyklymscvmsgteptlqleeadvmrdidsveltrfifyrldsptkgttr
fesaafpgwfictslqprqpvgitnqpdqvniatyklsg

SCOPe Domain Coordinates for d4x37a_:

Click to download the PDB-style file with coordinates for d4x37a_.
(The format of our PDB-style files is described here.)

Timeline for d4x37a_: