SCOPe 2.08: Domain d4v2ob1: 4v2o B:1-78

Lineage for d4v2ob1 (4v2o B:1-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.3: Saposin B [81806] (2 proteins)
   the alternative subunit conformation is an open four-helical bundle; helices 3 and 4 form a contiguous helix

6. Protein automated matches [279847] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [279848] (2 PDB entries)

8. Domain d4v2ob1: 4v2o B:1-78 [279851]
   Other proteins in same PDB: d4v2ob2, d4v2oc2
   automated match to d1n69a_
   complexed with clq

Details for d4v2ob1

PDB Entry: 4v2o, 2.13 Å

PDB Description: structure of saposin b in complex with chloroquine

PDB Compounds: (B:) saposin-b

SCOPe Domain Sequences for d4v2ob1:

Sequence; same for both SEQRES and ATOM records:

>d4v2ob1 a.64.1.3 (B:1-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdvcqdciqmvtdiqtavrtnstfvqalvehvkeecdrlgpgmadicknyisqyseiaiq
mmmhmqpkeicalvgfcd

Timeline for d4v2ob1:

• d4v2ob1 first appeared in SCOPe 2.05, called d4v2ob_
  
• d4v2ob1 appears in SCOPe 2.07