![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
![]() | Superfamily a.64.1: Saposin [47862] (5 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
![]() | Family a.64.1.3: Saposin B [81806] (2 proteins) the alternative subunit conformation is an open four-helical bundle; helices 3 and 4 form a contiguous helix |
![]() | Protein automated matches [279847] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [279848] (2 PDB entries) |
![]() | Domain d4v2oc1: 4v2o C:1-78 [279850] Other proteins in same PDB: d4v2ob2, d4v2oc2 automated match to d1n69a_ complexed with clq |
PDB Entry: 4v2o (more details), 2.13 Å
SCOPe Domain Sequences for d4v2oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v2oc1 a.64.1.3 (C:1-78) automated matches {Human (Homo sapiens) [TaxId: 9606]} gdvcqdciqmvtdiqtavrtnstfvqalvehvkeecdrlgpgmadicknyisqyseiaiq mmmhmqpkeicalvgfcd
Timeline for d4v2oc1: