Lineage for d4v2oc1 (4v2o C:1-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2717020Family a.64.1.3: Saposin B [81806] (2 proteins)
    the alternative subunit conformation is an open four-helical bundle; helices 3 and 4 form a contiguous helix
  6. 2717026Protein automated matches [279847] (1 species)
    not a true protein
  7. 2717027Species Human (Homo sapiens) [TaxId:9606] [279848] (2 PDB entries)
  8. 2717033Domain d4v2oc1: 4v2o C:1-78 [279850]
    Other proteins in same PDB: d4v2ob2, d4v2oc2
    automated match to d1n69a_
    complexed with clq

Details for d4v2oc1

PDB Entry: 4v2o (more details), 2.13 Å

PDB Description: structure of saposin b in complex with chloroquine
PDB Compounds: (C:) saposin-b

SCOPe Domain Sequences for d4v2oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v2oc1 a.64.1.3 (C:1-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdvcqdciqmvtdiqtavrtnstfvqalvehvkeecdrlgpgmadicknyisqyseiaiq
mmmhmqpkeicalvgfcd

SCOPe Domain Coordinates for d4v2oc1:

Click to download the PDB-style file with coordinates for d4v2oc1.
(The format of our PDB-style files is described here.)

Timeline for d4v2oc1: