SCOPe 2.08: Domain d4tlqb_: 4tlq B:

Lineage for d4tlqb_ (4tlq B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d4tlqb_: 4tlq B: [279846]
   automated match to d2mika_

Details for d4tlqb_

PDB Entry: 4tlq, 2.5 Å

PDB Description: crystal structure of c-terminal rna recognition motif of human elav type rna binding protein-3 at 2.5 angstrom resolution

PDB Compounds: (B:) CUGBP Elav-like family member 2

SCOPe Domain Sequences for d4tlqb_:

Sequence; same for both SEQRES and ATOM records:

>d4tlqb_ d.58.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsydnpvsa
qaaiqamngfqigmkrlkvqlkr

Timeline for d4tlqb_:

• d4tlqb_ first appeared in SCOPe 2.05
  
• d4tlqb_ appears in SCOPe 2.07