![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
![]() | Protein Plant pathogenesis-related protein PR10 [75543] (2 species) |
![]() | Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries) |
![]() | Domain d4ryva_: 4ryv A: [279844] automated match to d1icxa_ complexed with so4, zea |
PDB Entry: 4ryv (more details), 1.38 Å
SCOPe Domain Sequences for d4ryva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ryva_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh tkgdvlsetvrdqakfkglglfkaiegyvlahpdy
Timeline for d4ryva_: