![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein automated matches [190085] (47 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:272560] [279838] (1 PDB entry) |
![]() | Domain d4rlhb_: 4rlh B: [279839] automated match to d3ek2a_ complexed with 0we |
PDB Entry: 4rlh (more details), 2.26 Å
SCOPe Domain Sequences for d4rlhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rlhb_ c.2.1.2 (B:) automated matches {Burkholderia pseudomallei [TaxId: 272560]} mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv taevmhvdsgfnavvggm
Timeline for d4rlhb_: