Lineage for d1c3ma_ (1c3m A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813155Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2813156Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2813215Protein Heltuba lectin [51107] (1 species)
  7. 2813216Species Jerusalem artishoke (Helianthus tuberosus) [TaxId:4233] [51108] (3 PDB entries)
  8. 2813218Domain d1c3ma_: 1c3m A: [27983]

Details for d1c3ma_

PDB Entry: 1c3m (more details), 2 Å

PDB Description: crystal structure of heltuba complexed to man(1-3)man
PDB Compounds: (A:) agglutinin

SCOPe Domain Sequences for d1c3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ma_ b.77.3.1 (A:) Heltuba lectin {Jerusalem artishoke (Helianthus tuberosus) [TaxId: 4233]}
asdiavqagpwggnggkrwlqtahggkitsiiikggtcifsiqfvykdkdnieyhsgkfg
vlgdkaetitfaededitaisgtfgayyhmtvvtsltfqtnkkvygpfgtvasssfslpl
tkgkfagffgnsgdvldsiggvvvp

SCOPe Domain Coordinates for d1c3ma_:

Click to download the PDB-style file with coordinates for d1c3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ma_: