Lineage for d5ez4a_ (5ez4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909953Species Staphylococcus aureus [TaxId:1280] [225527] (6 PDB entries)
  8. 2909961Domain d5ez4a_: 5ez4 A: [279829]
    Other proteins in same PDB: d5ez4c2
    automated match to d4qn2a_
    complexed with epe, na, nad, pge; mutant

Details for d5ez4a_

PDB Entry: 5ez4 (more details), 2.11 Å

PDB Description: 2.11 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) p449m/y450l double mutant from staphylococcus aureus in complex with nad+ and bme-modified cys289
PDB Compounds: (A:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d5ez4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ez4a_ c.82.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafe
sgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfa
gladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmk
pseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftggietgkh
imknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqns
ikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkr
pdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglag
avfskdigkaqrvanklklgtvwindfhmlfaqapwggykqsgigrelgkegleeylvsk
hiltntnpqlvnwfsk

SCOPe Domain Coordinates for d5ez4a_:

Click to download the PDB-style file with coordinates for d5ez4a_.
(The format of our PDB-style files is described here.)

Timeline for d5ez4a_: