Lineage for d5eyub_ (5eyu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909953Species Staphylococcus aureus [TaxId:1280] [225527] (6 PDB entries)
  8. 2909958Domain d5eyub_: 5eyu B: [279828]
    automated match to d4qn2a_
    complexed with epe, na, nad, pge; mutant

Details for d5eyub_

PDB Entry: 5eyu (more details), 1.72 Å

PDB Description: 1.72 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) p449m point mutant from staphylococcus aureus in complex with nad+ and bme-modified cys289
PDB Compounds: (B:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d5eyub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eyub_ c.82.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
hlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafesgews
qetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfagladk
dggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmkpseit
plttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftggietgkhimkna
annvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqnsikdkf
eqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkrpdrdd
lkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglagavfsk
digkaqrvanklklgtvwindfhmyfaqapwggykqsgigrelgkegleeylvskhiltn
tnpqlvnwfsk

SCOPe Domain Coordinates for d5eyub_:

Click to download the PDB-style file with coordinates for d5eyub_.
(The format of our PDB-style files is described here.)

Timeline for d5eyub_: