Lineage for d5eyua_ (5eyu A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875981Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1875982Protein automated matches [190683] (38 species)
    not a true protein
  7. 1876531Species Staphylococcus aureus [TaxId:1280] [225527] (4 PDB entries)
  8. 1876534Domain d5eyua_: 5eyu A: [279826]
    automated match to d4qn2a_
    complexed with epe, na, nad, pge; mutant

Details for d5eyua_

PDB Entry: 5eyu (more details), 1.72 Å

PDB Description: 1.72 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) p449m point mutant from staphylococcus aureus in complex with nad+ and bme-modified cys289
PDB Compounds: (A:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d5eyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eyua_ c.82.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
hlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafesgews
qetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfagladk
dggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmkpseit
plttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftggietgkhimkna
annvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqnsikdkf
eqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkrpdrdd
lkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglagavfsk
digkaqrvanklklgtvwindfhmyfaqapwggykqsgigrelgkegleeylvskhiltn
tnpqlvnwfsk

SCOPe Domain Coordinates for d5eyua_:

Click to download the PDB-style file with coordinates for d5eyua_.
(The format of our PDB-style files is described here.)

Timeline for d5eyua_: