SCOPe 2.06: Domain d5e5eb_: 5e5e B:

Lineage for d5e5eb_ (5e5e B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries)

8. Domain d5e5eb_: 5e5e B: [279821]
   automated match to d1kf3a_
   complexed with dms, pt

Details for d5e5eb_

PDB Entry: 5e5e, 1.98 Å

PDB Description: x-ray structure of the adduct formed in the reaction between rnase a and a neutral organometallic derivative [pt(pbi)(me)(dmso)], pbi=2- (2'-pyridil)benzimidazole (compound 3)

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d5e5eb_:

Sequence; same for both SEQRES and ATOM records:

>d5e5eb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d5e5eb_:

• d5e5eb_ first appeared in SCOPe 2.05
  
• d5e5eb_ appears in SCOPe 2.07
  
• d5e5eb_ appears in the current release, SCOPe 2.08