Lineage for d5e0ie1 (5e0i E:0-148)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738833Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 1738834Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) (S)
    automatically mapped to Pfam PF00906
  5. 1738835Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 1738842Protein automated matches [191131] (3 species)
    not a true protein
  7. 1738843Species Hepatitis b virus genotype d subtype adw [TaxId:10419] [279810] (1 PDB entry)
  8. 1738848Domain d5e0ie1: 5e0i E:0-148 [279817]
    automated match to d4bmga_
    complexed with 5j6; mutant

Details for d5e0ie1

PDB Entry: 5e0i (more details), 1.95 Å

PDB Description: crystal structure of the hbv capsid y132a mutant (vcid 8772) in complex with nvr10-001e2 at 1.95a resolution
PDB Compounds: (E:) capsid protein

SCOPe Domain Sequences for d5e0ie1:

Sequence, based on SEQRES records: (download)

>d5e0ie1 a.62.1.1 (E:0-148) automated matches {Hepatitis b virus genotype d subtype adw [TaxId: 10419]}
smdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqai
lcwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleyl
vsfgvwirtppaarppnapilstlpettv

Sequence, based on observed residues (ATOM records): (download)

>d5e0ie1 a.62.1.1 (E:0-148) automated matches {Hepatitis b virus genotype d subtype adw [TaxId: 10419]}
smdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqai
lcwgdlmtlatwrdlvvsyvntnvglkfrqllwfhiscltfgretvleylvsfgvwirtp
paarppnapilstlpettv

SCOPe Domain Coordinates for d5e0ie1:

Click to download the PDB-style file with coordinates for d5e0ie1.
(The format of our PDB-style files is described here.)

Timeline for d5e0ie1: