| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) ![]() automatically mapped to Pfam PF00906 |
| Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
| Protein automated matches [191131] (3 species) not a true protein |
| Species Hepatitis b virus genotype d subtype adw [TaxId:10419] [279810] (1 PDB entry) |
| Domain d5e0ie1: 5e0i E:0-148 [279817] automated match to d4bmga_ complexed with 5j6; mutant |
PDB Entry: 5e0i (more details), 1.95 Å
SCOPe Domain Sequences for d5e0ie1:
Sequence, based on SEQRES records: (download)
>d5e0ie1 a.62.1.1 (E:0-148) automated matches {Hepatitis b virus genotype d subtype adw [TaxId: 10419]}
smdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqai
lcwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleyl
vsfgvwirtppaarppnapilstlpettv
>d5e0ie1 a.62.1.1 (E:0-148) automated matches {Hepatitis b virus genotype d subtype adw [TaxId: 10419]}
smdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqai
lcwgdlmtlatwrdlvvsyvntnvglkfrqllwfhiscltfgretvleylvsfgvwirtp
paarppnapilstlpettv
Timeline for d5e0ie1: