Lineage for d5e0ie1 (5e0i E:1-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716878Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2716879Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) (S)
    automatically mapped to Pfam PF00906
  5. 2716880Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2716887Protein automated matches [191131] (3 species)
    not a true protein
  7. 2716893Species Hepatitis B virus genotype d subtype adw [TaxId:10419] [189224] (4 PDB entries)
  8. 2716904Domain d5e0ie1: 5e0i E:1-148 [279817]
    Other proteins in same PDB: d5e0ia2, d5e0ia3, d5e0ib2, d5e0ib3, d5e0ic2, d5e0ic3, d5e0id2, d5e0ie2, d5e0ie3, d5e0if2, d5e0if3
    automated match to d4bmga_
    complexed with 5j6; mutant

Details for d5e0ie1

PDB Entry: 5e0i (more details), 1.95 Å

PDB Description: crystal structure of the hbv capsid y132a mutant (vcid 8772) in complex with nvr10-001e2 at 1.95a resolution
PDB Compounds: (E:) capsid protein

SCOPe Domain Sequences for d5e0ie1:

Sequence, based on SEQRES records: (download)

>d5e0ie1 a.62.1.1 (E:1-148) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilstlpettv

Sequence, based on observed residues (ATOM records): (download)

>d5e0ie1 a.62.1.1 (E:1-148) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwrdlvvsyvntnvglkfrqllwfhiscltfgretvleylvsfgvwirtpp
aarppnapilstlpettv

SCOPe Domain Coordinates for d5e0ie1:

Click to download the PDB-style file with coordinates for d5e0ie1.
(The format of our PDB-style files is described here.)

Timeline for d5e0ie1: