![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
![]() | Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) ![]() automatically mapped to Pfam PF00906 |
![]() | Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
![]() | Protein automated matches [191131] (3 species) not a true protein |
![]() | Species Hepatitis B virus genotype d subtype adw [TaxId:10419] [189224] (4 PDB entries) |
![]() | Domain d5e0id1: 5e0i D:1-148 [279816] Other proteins in same PDB: d5e0ia2, d5e0ia3, d5e0ib2, d5e0ib3, d5e0ic2, d5e0ic3, d5e0id2, d5e0ie2, d5e0ie3, d5e0if2, d5e0if3 automated match to d4bmga_ complexed with 5j6; mutant |
PDB Entry: 5e0i (more details), 1.95 Å
SCOPe Domain Sequences for d5e0id1:
Sequence, based on SEQRES records: (download)
>d5e0id1 a.62.1.1 (D:1-148) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]} mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv sfgvwirtppaarppnapilstlpettv
>d5e0id1 a.62.1.1 (D:1-148) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]} mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail cwgdlmtlatwvsrdlvvsyvntnvglkfrqllwfhiscltfgretvleylvsfgvwirt ppaarppnapilstlpettv
Timeline for d5e0id1: