Lineage for d5dz2a_ (5dz2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011012Species Streptomyces coelicolor [TaxId:100226] [279808] (16 PDB entries)
  8. 2011022Domain d5dz2a_: 5dz2 A: [279815]
    automated match to d1ps1a_
    complexed with 212, mg

Details for d5dz2a_

PDB Entry: 5dz2 (more details), 2.11 Å

PDB Description: geosmin synthase from streptomyces coelicolor n-terminal domain complexed with three mg2+ ions and alendronic acid
PDB Compounds: (A:) Germacradienol/geosmin synthase

SCOPe Domain Sequences for d5dz2a_:

Sequence, based on SEQRES records: (download)

>d5dz2a_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
qpfqlphfylphparlnphldearahsttwaremgmlegsgvweqsdleahdygllcayt
hpdcdgpalslitdwyvwvfffddhflekykrsqdrlagkahldrlplfmplddaagmpe
prnpveagladlwtrtvpamsadwrrrfavatehllnesmwelsninegrvanpveyiem
rrkvggapwsaglveyataevpaavagtrplrvlmetfsdavhlrndlfsyqrevedege
lsngvlvletffgcttqeaadlvndvltsrlhqfehtaftevpavalekgltplevaavg
aytkglqdwqsgghewhmrssrymnk

Sequence, based on observed residues (ATOM records): (download)

>d5dz2a_ a.128.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
qpfqlphfylphparlnphldearahsttwaremgmlegsgvweqsdleahdygllcayt
hpdcdgpalslitdwyvwvfffddhflekykrsqdrlagkahldrlplfmplgmpeprnp
veagladlwtrtvpamsadwrrrfavatehllnesmwelsninegrvanpveyiemrrkv
ggapwsaglveyataevpaavagtrplrvlmetfsdavhlrndlfsyqrevedegelsng
vlvletffgcttqeaadlvndvltsrlhqfehtaftevpavalekgltplevaavgaytk
glqdwqsgghewhmrssrymnk

SCOPe Domain Coordinates for d5dz2a_:

Click to download the PDB-style file with coordinates for d5dz2a_.
(The format of our PDB-style files is described here.)

Timeline for d5dz2a_: