SCOPe 2.05: Domain d5e0if1: 5e0i F:0-148

Lineage for d5e0if1 (5e0i F:0-148)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
   5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle

4. Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family)
   automatically mapped to Pfam PF00906

5. Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)

6. Protein automated matches [191131] (3 species)
   not a true protein

7. Species Hepatitis b virus genotype d subtype adw [TaxId:10419] [279810] (1 PDB entry)

8. Domain d5e0if1: 5e0i F:0-148 [279814]
   automated match to d4bmga_
   complexed with 5j6; mutant

Details for d5e0if1

PDB Entry: 5e0i, 1.95 Å

PDB Description: crystal structure of the hbv capsid y132a mutant (vcid 8772) in complex with nvr10-001e2 at 1.95a resolution

PDB Compounds: (F:) capsid protein

SCOPe Domain Sequences for d5e0if1:

Sequence, based on SEQRES records:

>d5e0if1 a.62.1.1 (F:0-148) automated matches {Hepatitis b virus genotype d subtype adw [TaxId: 10419]}
smdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqai
lcwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleyl
vsfgvwirtppaarppnapilstlpettv

Sequence, based on observed residues (ATOM records):

>d5e0if1 a.62.1.1 (F:0-148) automated matches {Hepatitis b virus genotype d subtype adw [TaxId: 10419]}
smdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqai
lcwgdlmtlatwvntnvglkfrqllwfhiscltfgretvleylvsfgvwirtppaarppn
apilstlpettv

Timeline for d5e0if1:

• d5e0if1 is new in SCOPe 2.05-stable
  
• d5e0if1 appears in SCOPe 2.06
  
• d5e0if1 appears in the current release, SCOPe 2.08