Lineage for d5d3ka_ (5d3k A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508837Family c.69.1.22: Thioesterase domain of polypeptide, polyketide and fatty acid synthases [69584] (4 proteins)
    Pfam PF00975
  6. 2508838Protein Erythromycin polyketide synthase [69585] (1 species)
    synonym: 6-deoxyerythronolide synthase
  7. 2508839Species Saccharopolyspora erythraea [TaxId:1836] [69586] (5 PDB entries)
  8. 2508840Domain d5d3ka_: 5d3k A: [279806]
    automated match to d1keza_
    complexed with 1pe, ca

Details for d5d3ka_

PDB Entry: 5d3k (more details), 1.7 Å

PDB Description: crystal structure of the thioesterase domain of deoxyerythronolide b synthase
PDB Compounds: (A:) Erythronolide synthase, modules 5 and 6

SCOPe Domain Sequences for d5d3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d3ka_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}
ssalrdgyrqagvsgrvrsyldllaglsdfrehfdgsdgfsldlvdmadgpgevtvicca
gtaaisgpheftrlagalrgiapvravpqpgyeegeplpssmaavaavqadavirtqgdk
pfvvaghsagalmayalatelldrghpprgvvlidvyppghqdamnawleeltatlfdre
tvrmddtrltalgaydrltgqwrpretglptllvsagepmgpwpddswkptwpfehdtva
vpgdhftmvqehadaiarhidawlgggns

SCOPe Domain Coordinates for d5d3ka_:

Click to download the PDB-style file with coordinates for d5d3ka_.
(The format of our PDB-style files is described here.)

Timeline for d5d3ka_: