Lineage for d5d0kj1 (5d0k J:1-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939164Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (31 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 2939203Domain d5d0kj1: 5d0k J:1-147 [279803]
    Other proteins in same PDB: d5d0ka2, d5d0kb_, d5d0kd2, d5d0ke_, d5d0kg2, d5d0kh_, d5d0kj2, d5d0kk_
    automated match to d3tgda_
    complexed with zn

Details for d5d0kj1

PDB Entry: 5d0k (more details), 2.65 Å

PDB Description: structure of ube2d2:rnf165:ub complex
PDB Compounds: (J:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5d0kj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d0kj1 d.20.1.1 (J:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqssagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5d0kj1:

Click to download the PDB-style file with coordinates for d5d0kj1.
(The format of our PDB-style files is described here.)

Timeline for d5d0kj1: