SCOPe 2.08: Domain d5d0kj1: 5d0k J:1-147

Lineage for d5d0kj1 (5d0k J:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (31 PDB entries)
   Uniprot P62837
   E2-17 kDa 2

8. Domain d5d0kj1: 5d0k J:1-147 [279803]
   Other proteins in same PDB: d5d0ka2, d5d0kb_, d5d0kd2, d5d0ke_, d5d0kg2, d5d0kh_, d5d0kj2, d5d0kk_
   automated match to d3tgda_
   complexed with zn

Details for d5d0kj1

PDB Entry: 5d0k, 2.65 Å

PDB Description: structure of ube2d2:rnf165:ub complex

PDB Compounds: (J:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5d0kj1:

Sequence; same for both SEQRES and ATOM records:

>d5d0kj1 d.20.1.1 (J:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqssagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d5d0kj1:

• d5d0kj1 first appeared in SCOPe 2.05, called d5d0kj_
  
• d5d0kj1 appears in SCOPe 2.07