SCOPe 2.08: Domain d5d0ma_: 5d0m A:

Lineage for d5d0ma_ (5d0m A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (31 PDB entries)
   Uniprot P62837
   E2-17 kDa 2

8. Domain d5d0ma_: 5d0m A: [279797]
   Other proteins in same PDB: d5d0mb_
   automated match to d3tgda_
   complexed with po4, zn

Details for d5d0ma_

PDB Entry: 5d0m, 1.91 Å

PDB Description: structure of ube2d2:rnf165:ub complex

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5d0ma_:

Sequence; same for both SEQRES and ATOM records:

>d5d0ma_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqsragpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d5d0ma_:

• d5d0ma_ first appeared in SCOPe 2.05
  
• d5d0ma_ appears in SCOPe 2.07