| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) ![]() |
| Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins) |
| Protein automated matches [190278] (5 species) not a true protein |
| Species Vibrio cholerae [TaxId:666] [279784] (1 PDB entry) |
| Domain d5cxkf_: 5cxk F: [279793] automated match to d3qy1a_ complexed with bct, zn |
PDB Entry: 5cxk (more details), 1.9 Å
SCOPe Domain Sequences for d5cxkf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cxkf_ c.53.2.1 (F:) automated matches {Vibrio cholerae [TaxId: 666]}
mpeikqlfennskwsasikaetpeyfaklakgqnpdflwigcadsrvpaerltglysgel
fvhrnvanqvihtdlnclsvvqyavdvlqvkhiivcghygcggvtaaidnpqlglinnwl
lhirdyylkhreyldkmpaedrsdklaeinvaeqvynlanstvlqnawergqavevhgfv
ygiedgrleylgvrcasrsavednyhkalekilnpnhrllcr
Timeline for d5cxkf_: