Lineage for d1jac.6 (1jac D:,C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1805894Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1805934Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 1805935Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 1805993Protein Jacalin [51103] (2 species)
  7. 1806003Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)
  8. 1806027Domain d1jac.6: 1jac D:,C: [27979]
    complexed with amg

Details for d1jac.6

PDB Entry: 1jac (more details), 2.43 Å

PDB Description: a novel mode of carbohydrate recognition in jacalin, a moraceae plant lectin with a beta-prism
PDB Compounds: (C:) jacalin, (D:) jacalin

SCOPe Domain Sequences for d1jac.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g1jac.6 b.77.3.1 (D:,C:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgksqtvivgswgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

SCOPe Domain Coordinates for d1jac.6:

Click to download the PDB-style file with coordinates for d1jac.6.
(The format of our PDB-style files is described here.)

Timeline for d1jac.6: