Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) |
Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins) |
Protein automated matches [190278] (5 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [279784] (1 PDB entry) |
Domain d5cxka_: 5cxk A: [279788] automated match to d3qy1a_ complexed with bct, zn |
PDB Entry: 5cxk (more details), 1.9 Å
SCOPe Domain Sequences for d5cxka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cxka_ c.53.2.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]} mpeikqlfennskwsasikaetpeyfaklakgqnpdflwigcadsrvpaerltglysgel fvhrnvanqvihtdlnclsvvqyavdvlqvkhiivcghygcggvtaaidnpqlglinnwl lhirdyylkhreyldkmpaedrsdklaeinvaeqvynlanstvlqnawergqavevhgfv ygiedgrleylgvrcasrsavednyhkalekilnpnhrllcr
Timeline for d5cxka_: