Lineage for d5cxka_ (5cxk A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857121Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1857166Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 1857167Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 1857199Protein automated matches [190278] (5 species)
    not a true protein
  7. 1857275Species Vibrio cholerae [TaxId:666] [279784] (1 PDB entry)
  8. 1857276Domain d5cxka_: 5cxk A: [279788]
    automated match to d3qy1a_
    complexed with bct, zn

Details for d5cxka_

PDB Entry: 5cxk (more details), 1.9 Å

PDB Description: crystal structure of beta carbonic anhydrase from vibrio cholerae
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d5cxka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cxka_ c.53.2.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
mpeikqlfennskwsasikaetpeyfaklakgqnpdflwigcadsrvpaerltglysgel
fvhrnvanqvihtdlnclsvvqyavdvlqvkhiivcghygcggvtaaidnpqlglinnwl
lhirdyylkhreyldkmpaedrsdklaeinvaeqvynlanstvlqnawergqavevhgfv
ygiedgrleylgvrcasrsavednyhkalekilnpnhrllcr

SCOPe Domain Coordinates for d5cxka_:

Click to download the PDB-style file with coordinates for d5cxka_.
(The format of our PDB-style files is described here.)

Timeline for d5cxka_: