Lineage for d5cg0d_ (5cg0 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083928Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [279776] (1 PDB entry)
  8. 2083932Domain d5cg0d_: 5cg0 D: [279781]
    automated match to d3viia_
    complexed with nag, trs

Details for d5cg0d_

PDB Entry: 5cg0 (more details), 2.09 Å

PDB Description: crystal structure of spodoptera frugiperda beta-glycosidase
PDB Compounds: (D:) Beta-glucosidase

SCOPe Domain Sequences for d5cg0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cg0d_ c.1.8.0 (D:) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
rrfpddflfgtatasyqiegawdedgkgeniwdymvhntpevirdlsngdiaadsyhnyk
rdvemmrelgldayrfslswarilptgmanevnpagiafynnyidemlkynitplitlyh
wdlpqklqelggfanplisdwfedyarvvfenfgdrvkmfitfnepreicfegygsatka
pilnatamgaylcaknlvtahakayylydrefrpvqggqcgitisvnwfgpatptpedem
aaelrrqgewgiyahpifsaeggfpkelsdkiaeksaqqgypwsrlpefteeekafvrgt
sdffgvnhytaflvsaterkgpypvpsllddvdtgswaddswlksasawltlapnsihta
lthlnnlynkpvfyitengwstdesrenslidddriqyyrasmesllnclddginlkgym
awslmdnfewmegyierfglyevdfsdpartrtprkaafvykhiikhrvvdyeyepetmv
mtideg

SCOPe Domain Coordinates for d5cg0d_:

Click to download the PDB-style file with coordinates for d5cg0d_.
(The format of our PDB-style files is described here.)

Timeline for d5cg0d_: