Lineage for d5aa7b_ (5aa7 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766333Species Jonesia denitrificans [TaxId:43674] [279770] (1 PDB entry)
  8. 2766335Domain d5aa7b_: 5aa7 B: [279773]
    automated match to d4a02a_
    complexed with cu1

Details for d5aa7b_

PDB Entry: 5aa7 (more details), 1.55 Å

PDB Description: structural and functional characterization of a chitin-active 15.5 kda lytic polysaccharide monooxygenase domain from a modular chitinase from jonesia denitrificans
PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d5aa7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aa7b_ b.1.18.0 (B:) automated matches {Jonesia denitrificans [TaxId: 43674]}
hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
larwnvsntnnafyncmdvvvs

SCOPe Domain Coordinates for d5aa7b_:

Click to download the PDB-style file with coordinates for d5aa7b_.
(The format of our PDB-style files is described here.)

Timeline for d5aa7b_: