| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Jonesia denitrificans [TaxId:43674] [279770] (1 PDB entry) |
| Domain d5aa7b_: 5aa7 B: [279773] automated match to d4a02a_ complexed with cu1 |
PDB Entry: 5aa7 (more details), 1.55 Å
SCOPe Domain Sequences for d5aa7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aa7b_ b.1.18.0 (B:) automated matches {Jonesia denitrificans [TaxId: 43674]}
hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
larwnvsntnnafyncmdvvvs
Timeline for d5aa7b_: