SCOPe 2.08: Domain d5aa7b_: 5aa7 B:

Lineage for d5aa7b_ (5aa7 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Jonesia denitrificans [TaxId:43674] [279770] (1 PDB entry)

8. Domain d5aa7b_: 5aa7 B: [279773]
   automated match to d4a02a_
   complexed with cu1

Details for d5aa7b_

PDB Entry: 5aa7, 1.55 Å

PDB Description: structural and functional characterization of a chitin-active 15.5 kda lytic polysaccharide monooxygenase domain from a modular chitinase from jonesia denitrificans

PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d5aa7b_:

Sequence; same for both SEQRES and ATOM records:

>d5aa7b_ b.1.18.0 (B:) automated matches {Jonesia denitrificans [TaxId: 43674]}
hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
larwnvsntnnafyncmdvvvs

Timeline for d5aa7b_:

• d5aa7b_ first appeared in SCOPe 2.05
  
• d5aa7b_ appears in SCOPe 2.07