Lineage for d4rsna_ (4rsn A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1743742Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1744216Protein automated matches [190068] (8 species)
    not a true protein
  7. 1744217Species Bacillus megaterium [TaxId:1404] [188479] (4 PDB entries)
  8. 1744224Domain d4rsna_: 4rsn A: [279757]
    automated match to d4kpaa_
    complexed with hem; mutant

Details for d4rsna_

PDB Entry: 4rsn (more details), 2.7 Å

PDB Description: crystal structure of the e267v mutant of cytochrome p450 bm3
PDB Compounds: (A:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d4rsna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rsna_ a.104.1.1 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
rgshmtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapglvtrflssq
rlikeacdesrfdknlsqalkfvrdfagdglvtswtheknwkkahnillpsfsqqamkgy
hammvdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfit
smvraldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllt
hmlngkdpetgeplddeniryqiitfliaghvttsgllsfalyflvknphvlqkaaeeaa
rvlvdpvpsykqvkqlkyvdmvlnealrlwptapafslyakedtvlggkyplekgdelmv
lipqlhrdktiwgddveefrperfenpsaipqhafkpfgngqracpgqqfalheatlvlg
mmlkhfdfedhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d4rsna_:

Click to download the PDB-style file with coordinates for d4rsna_.
(The format of our PDB-style files is described here.)

Timeline for d4rsna_:

  • d4rsna_ appears in periodic updates to SCOPe 2.05 starting on 2015-12-02
  • d4rsna_ is called d4rsna1 in SCOPe 2.06
  • d4rsna_ appears in the current release, SCOPe 2.07, called d4rsna1