| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (9 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:559292] [279753] (3 PDB entries) |
| Domain d2mzra_: 2mzr A: [279756] automated match to d2dh9a_ |
PDB Entry: 2mzr (more details)
SCOPe Domain Sequences for d2mzra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mzra_ d.58.7.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
gsareldstyeekvnrnysnsifvgnltydstpedlteffsqigkvvradiitsrghhrg
mgtveftnsddvdrairqydgaffmdrkifvrqdn
Timeline for d2mzra_: