Lineage for d2mzra_ (2mzr A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908987Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1908988Protein automated matches [190896] (9 species)
    not a true protein
  7. 1909134Species Saccharomyces cerevisiae [TaxId:559292] [279753] (3 PDB entries)
  8. 1909136Domain d2mzra_: 2mzr A: [279756]
    automated match to d2dh9a_

Details for d2mzra_

PDB Entry: 2mzr (more details)

PDB Description: nmr structure of the rrm1 domain of hrb1
PDB Compounds: (A:) Protein HRB1

SCOPe Domain Sequences for d2mzra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mzra_ d.58.7.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
gsareldstyeekvnrnysnsifvgnltydstpedlteffsqigkvvradiitsrghhrg
mgtveftnsddvdrairqydgaffmdrkifvrqdn

SCOPe Domain Coordinates for d2mzra_:

Click to download the PDB-style file with coordinates for d2mzra_.
(The format of our PDB-style files is described here.)

Timeline for d2mzra_: