SCOPe 2.08: Domain d2mzqa1: 2mzq A:329-427

Lineage for d2mzqa1 (2mzq A:329-427)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries)

8. Domain d2mzqa1: 2mzq A:329-427 [279755]
   Other proteins in same PDB: d2mzqa2
   automated match to d1x4aa1

Details for d2mzqa1

PDB Entry: 2mzq

PDB Description: nmr structure of the rrm3 domain of gbp2

PDB Compounds: (A:) Single-strand telomeric DNA-binding protein GBP2

SCOPe Domain Sequences for d2mzqa1:

Sequence; same for both SEQRES and ATOM records:

>d2mzqa1 d.58.7.0 (A:329-427) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
hidetaakftegvnpggdrncfiycsnlpfstarsdlfdlfgpigkinnaelkpqengqp
tgvavveyenlvdadfciqklnnynyggcslqisyarrd

Timeline for d2mzqa1:

• d2mzqa1 first appeared in SCOPe 2.05, called d2mzqa_
  
• d2mzqa1 appears in SCOPe 2.07