SCOPe 2.08: Domain d2mzsa1: 2mzs A:262-358

Lineage for d2mzsa1 (2mzs A:262-358)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries)

8. Domain d2mzsa1: 2mzs A:262-358 [279754]
   Other proteins in same PDB: d2mzsa2
   automated match to d2dh9a_

Details for d2mzsa1

PDB Entry: 2mzs

PDB Description: nmr structure of the rrm2 domain of hrb1

PDB Compounds: (A:) Protein HRB1

SCOPe Domain Sequences for d2mzsa1:

Sequence; same for both SEQRES and ATOM records:

>d2mzsa1 d.58.7.0 (A:262-358) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
evivknlpasvnwqalkdifkecgnvahadveldgdgvstgsgtvsfydikdlhraieky
ngysiegnvldvkskesvhnhsdgddvdipmddspvn

Timeline for d2mzsa1:

• d2mzsa1 first appeared in SCOPe 2.05, called d2mzsa_
  
• d2mzsa1 appears in SCOPe 2.07