![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries) |
![]() | Domain d2mzsa1: 2mzs A:262-358 [279754] Other proteins in same PDB: d2mzsa2 automated match to d2dh9a_ |
PDB Entry: 2mzs (more details)
SCOPe Domain Sequences for d2mzsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mzsa1 d.58.7.0 (A:262-358) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} evivknlpasvnwqalkdifkecgnvahadveldgdgvstgsgtvsfydikdlhraieky ngysiegnvldvkskesvhnhsdgddvdipmddspvn
Timeline for d2mzsa1: