SCOPe 2.05: Domain d4lhkb_: 4lhk B:

Lineage for d4lhkb_ (4lhk B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
   core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains

4. Superfamily b.179.1: PA14-like [254123] (3 families)

5. Family b.179.1.2: GLEYA domain [254187] (2 proteins)
   Pfam PF10528
   PubMed 21149680; inserted Flo5 subdomain (84-120) contains 5 short beta strands and two disulfide bridges

6. Protein automated matches [254737] (2 species)
   not a true protein

7. Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [267943] (2 PDB entries)

8. Domain d4lhkb_: 4lhk B: [279751]
   automated match to d4gq7a_
   complexed with ca

Details for d4lhkb_

PDB Entry: 4lhk, 1.73 Å

PDB Description: structure of the n-terminal domain of the lg-flo1 adhesin (n-lg-flo1p) from the yeast saccharomyces pastorianus, in complex with calcium and alpha-1,2-mannobiose

PDB Compounds: (B:) Flocculin

SCOPe Domain Sequences for d4lhkb_:

Sequence; same for both SEQRES and ATOM records:

>d4lhkb_ b.179.1.2 (B:) automated matches {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}
tqaclpvgsrkngmnvnfykyslqdsttysdpqymaykysdtkklgsvsgqthlsiyydl
ntafwntaswssdlfgfyttptnvtvemtgyflppqtgsytfkfatvddsailsvggsia
feccaqeqppitstdftingikpwgaaaptdikgstymyagyyypikivysnakalarlp
vsvvlpdgtevnddfegyvysfdddlsqsnctipdps

Timeline for d4lhkb_:

• d4lhkb_ is new in SCOPe 2.05-stable
  
• d4lhkb_ appears in SCOPe 2.06
  
• d4lhkb_ appears in the current release, SCOPe 2.08